PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P15140_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 739aa    MW: 82083.3 Da    PI: 6.573
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P15140_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.5e-191671156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                           +++ +++++ q++eLe+lF+ + +p++++r +L++ lgL+ rq+k+WFqNrR+++k
  GSMUA_Achr2P15140_001 16 KKRYHRHNPRQIQELESLFKVCLHPDEKQRLQLSRDLGLEPRQIKFWFQNRRTQMK 71
                           688899***********************************************998 PP

2START173.31.5e-542194413206
                            HHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
                  START   3 aeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                            a  a++e++++++ +ep+Wvkss      + e++d   q++ +         ++ea+r+s++v+m +++l   ++d + +W e ++  
  GSMUA_Achr2P15140_001 219 ATGAMEEVIRLVQTDEPLWVKSSdgrdilQLETYDSMFQRLGR--QlkfpgTRIEASRDSALVIMGAMTLIDMFMDAS-KWAELFPti 303
                            66799********************977777777777777755..256999***************************.****99999 PP

                            ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEE CS
                  START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliep 156
                              ka t+ev+  g      g l lm+ e q+lsp+vp R+f f+Ry++q + g+wv++dvSvd ++++   + + R+++lpSg+lie+
  GSMUA_Achr2P15140_001 304 vsKARTIEVLAAGmagsrsGSLLLMYEEIQVLSPVVPmREFCFLRYCQQIEPGVWVVADVSVDYPRDNR-LALSSRSRRLPSGYLIEE 390
                            99******************************************************************9.7***************** PP

                            ECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                  START 157 ksnghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                            ++ng++k+twveh++ +++ p h l+r l++sg+ +ga++w+a+lqr ce+
  GSMUA_Achr2P15140_001 391 MPNGYTKLTWVEHMEIEDKNPiHILFRDLINSGMLFGAQRWLAALQRMCER 441
                            *************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-19371IPR009057Homeodomain-like
SuperFamilySSF466891.67E-18771IPR009057Homeodomain-like
PROSITE profilePS5007116.521373IPR001356Homeobox domain
SMARTSM003894.4E-161477IPR001356Homeobox domain
CDDcd000863.78E-161571No hitNo description
PfamPF000462.1E-161671IPR001356Homeobox domain
PROSITE patternPS0002704871IPR017970Homeobox, conserved site
PROSITE profilePS5084851.336208444IPR002913START domain
SuperFamilySSF559611.75E-35210442No hitNo description
CDDcd088751.08E-105212440No hitNo description
SMARTSM002342.3E-47217441IPR002913START domain
PfamPF018521.1E-46221441IPR002913START domain
Gene3DG3DSA:3.30.530.206.6E-10277440IPR023393START-like domain
SuperFamilySSF559612.91E-21461698No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 739 aa     Download sequence    Send to blast
MDSGDEQDVP NSQSRKKRYH RHNPRQIQEL ESLFKVCLHP DEKQRLQLSR DLGLEPRQIK  60
FWFQNRRTQM KATAALFSSF QRADNCLLRA ENDKIRCENI AMREALKNVI CPSCGGPPPD  120
DDSYFDEQKL RMDNTRLKEE LDRVSNLASK YLGRPLTQLP PVQPVSLSSL DLSAGGYGDA  180
GISPSLDLDL LCRSSSSAFP FQCPSTVSDL EKPLMVEMAT GAMEEVIRLV QTDEPLWVKS  240
SDGRDILQLE TYDSMFQRLG RQLKFPGTRI EASRDSALVI MGAMTLIDMF MDASKWAELF  300
PTIVSKARTI EVLAAGMAGS RSGSLLLMYE EIQVLSPVVP MREFCFLRYC QQIEPGVWVV  360
ADVSVDYPRD NRLALSSRSR RLPSGYLIEE MPNGYTKLTW VEHMEIEDKN PIHILFRDLI  420
NSGMLFGAQR WLAALQRMCE RFACLNVAGL PARDIGVAPS PDGKRSMMKL AQRMLSSFCA  480
NVGASNGHQW NTISGLNDVG VRVTIHKTTD AGRPDGIVLN AATSMWLPIS SEKVFGFFKD  540
ERTRSQWDVL SNGNTLQEVA HITNGSHPGN CISLLRVCSF SLGLNSGQNT MLILQECCTD  600
AYGSVIVYSP VDLPAINIVM SGEDPSYIPI LPSGFTILPD GRAAAGASSS SNPMVGSSGS  660
LLTVAFQILM SGLPSAKLNL ESVMTVNNLI GTTVQQIKSA LNCTCINSCN FLKDLCSWLN  720
GWFLHISWLH LFVQMLPKY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009388746.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLM0S8550.0M0S855_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P15140_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11